NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1554 [new locus tag: NWMN_RS08710 ]
- pan locus tag?: SAUPAN004260000
- symbol: NWMN_1554
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1554 [new locus tag: NWMN_RS08710 ]
- symbol: NWMN_1554
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1719179..1719463
- length: 285
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330925 NCBI
- RefSeq: YP_001332588 NCBI
- BioCyc:
- MicrobesOnline: 3707106 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGACTCTATTTATTATTATCGGGGTTCTCGTGCCAATGGTTTATACCATGCAGTTAAAT
ATTAAAAATGAACCTGTAACAAAGCGCAATCTTTTAATAACATTAGCTTTATCTACGTTA
GGTATTTTAGTAACCGCGTTAGCAGGTGTAATCGTTACGAAACAAGCTTTTCCTTTATTA
AGTGTAGCAATTGGCTCAATTTTTACTGGAATCGTTTGGGGCCTTTTACTAAGTGGTAGC
TACGCGCTGATACGATTTTTATCTAACGCATTTGGGCGTAAGTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1554 [new locus tag: NWMN_RS08710 ]
- symbol: NWMN_1554
- description: hypothetical protein
- length: 94
- theoretical pI: 11.2593
- theoretical MW: 10120.3
- GRAVY: 1.15638
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined DUF1705; Domain of unknown function (DUF1705) (PF08019; HMM-score: 13.2)and 3 moreDUF5467; Family of unknown function (DUF5467) (PF17555; HMM-score: 9.3)GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 8.2)no clan defined DUF3481; C-terminal domain of neuropilin glycoprotein (PF11980; HMM-score: 7.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 0
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025897
- TAT(Tat/SPI): 0.001093
- LIPO(Sec/SPII): 0.028258
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLFIIIGVLVPMVYTMQLNIKNEPVTKRNLLITLALSTLGILVTALAGVIVTKQAFPLLSVAIGSIFTGIVWGLLLSGSYALIRFLSNAFGRK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.