Jump to navigation
Jump to search
m (Text replacement - "gene Genbank" to "gene RefSeq") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene GI</aureodatabase> | *<aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene RefSeq</aureodatabase> | *<aureodatabase>gene RefSeq</aureodatabase> | ||
*<aureodatabase>gene BioCyc</aureodatabase> | |||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 78: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 97: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 106: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 114: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 134: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 140: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 146: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 152: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 17:08, 10 March 2016
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1380 [new locus tag: NWMN_RS07770 ]
- pan locus tag?: SAUPAN003931000
- symbol: ubiE
- pan gene symbol?: ubiE
- synonym:
- product: ubiquinone/menaquinone biosynthesis methyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1380 [new locus tag: NWMN_RS07770 ]
- symbol: ubiE
- product: ubiquinone/menaquinone biosynthesis methyltransferase
- replicon: chromosome
- strand: -
- coordinates: 1546717..1547442
- length: 726
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331996 NCBI
- RefSeq: YP_001332414 NCBI
- BioCyc:
- MicrobesOnline: 3706932 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGGCTGACAATAAAGCAAATAAAGAGCAAGTACATCGCGTTTTTCAAAATATTTCAAAA
AAATATGATAGATTAAATAATATTATTAGTTTTGAGCAGCATAAAGTATGGAGAAAACGC
GTCATGAAAGACATGGGTGTTAGAAAAGGGACGAAAGCATTAGATGTTTGTTGTGGTACT
GGTGATTGGACAATCGCATTAAGCAAAGCTGTAGGACCAACAGGTGAAGTTACTGGTATT
GACTTTAGTGAGAATATGTTAGAAGTAGGAAAAGAAAAAACTGCTTCAATGGAAAATGTT
AAACTTGTTCATGGTGATGCAATGGAATTGCCGTTTGAAGACAATTCTTTTGATTATGTA
ACAATTGGGTTTGGATTAAGAAATGTGCCAGACTATTTAGTCGCGTTAAAAGAAATGAAT
AGAGTACTTAAACCAGGTGGTATGGTGGTATGTCTTGAAACGAGCCAACCAACTTTGCCA
GTCTTTAAACAAATGTATGCACTATACTTTAAATTTGTTATGCCTATTTTTGGAAAATTA
TTTGCAAAATCAAAAGAAGAATATGAATGGTTACAGCAATCTACGTTTAATTTTCCTGGA
AAAGAAGAGTTGAAGCGCATGTTTGAAGAAGCAGGTTTCATAAATGTAAGAGTACGTAGT
TTTACAGGGGGCGTTGCTGCAATGCACCTTGGCTATAAAGAAAAAGATAATACCAAAGGT
GATTAA60
120
180
240
300
360
420
480
540
600
660
720
726
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1380 [new locus tag: NWMN_RS07770 ]
- symbol: UbiE
- description: ubiquinone/menaquinone biosynthesis methyltransferase
- length: 241
- theoretical pI: 9.02909
- theoretical MW: 27422.5
- GRAVY: -0.378838
⊟Function[edit | edit source]
- reaction: EC 2.1.1.163? ExPASyDemethylmenaquinone methyltransferase A demethylmenaquinol + S-adenosyl-L-methionine = a menaquinol + S-adenosyl-L-homocysteine
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 402.2)and 23 moreBiosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 300.9)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 64.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 41.7)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 36.6)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 36.5)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 31.4)Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 31.3)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 30)methyltransferase, FxLD system (TIGR04364; HMM-score: 28.8)Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 27.2)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 23.8)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 23.2)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 21.6)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 20.5)Protein synthesis tRNA and rRNA base modification ribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 16.6)Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.9)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.5)Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 15.3)methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 13.6)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 12.7)Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 12.3)2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 11.3)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: NADP_Rossmann (CL0063) Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 323.4)and 23 moreMethyltransf_25; Methyltransferase domain (PF13649; HMM-score: 93.5)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 85.6)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 80.4)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 65.1)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 56.5)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 39.8)FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 30.6)Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 28.8)MTS; Methyltransferase small domain (PF05175; HMM-score: 21.7)CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 21.5)MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 21)Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 20.8)GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 20.3)Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 19.2)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 17.5)Rsm22; Mitochondrial small ribosomal subunit Rsm22 (PF09243; HMM-score: 17.4)NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 14.7)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.5)Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.5)Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 13.8)Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 13.1)ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 12.7)Methyltransf_29; Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.061569
- TAT(Tat/SPI): 0.000665
- LIPO(Sec/SPII): 0.000878
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MADNKANKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKGD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_1605 (ackA) acetate kinase [1] (data from MRSA252) NWMN_0577 (adh1) alcohol dehydrogenase [1] (data from MRSA252) NWMN_0372 (ahpC) alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) NWMN_2534 (arcA) arginine deiminase [1] (data from MRSA252) NWMN_2533 (arcB) ornithine carbamoyltransferase [1] (data from MRSA252) NWMN_1365 (asnC) asparaginyl-tRNA synthetase [1] (data from MRSA252) NWMN_1587 (citC) isocitrate dehydrogenase [1] (data from MRSA252) NWMN_1568 (clpX) ATP-dependent protease ATP-binding subunit ClpX [1] (data from MRSA252) NWMN_1483 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) NWMN_0082 (dra) deoxyribose-phosphate aldolase [1] (data from MRSA252) NWMN_1433 (efp) elongation factor P [1] (data from MRSA252) NWMN_0745 (eno) phosphopyruvate hydratase [1] (data from MRSA252) NWMN_0551 (eutD) phosphotransacetylase [1] (data from MRSA252) NWMN_1141 (fabG) 3-oxoacyl-[acyl-carrier protein] reductase [1] (data from MRSA252) NWMN_2029 (fbaA) fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_1625 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) NWMN_1169 (frr) ribosome recycling factor [1] (data from MRSA252) NWMN_1096 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) NWMN_0509 (fus) elongation factor G [1] (data from MRSA252) NWMN_0741 (gapA) glyceraldehyde 3-phosphate dehydrogenase 1 [1] (data from MRSA252) NWMN_1580 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) NWMN_1839 (gatC) aspartyl/glutamyl-tRNA amidotransferase subunit C [1] (data from MRSA252) NWMN_2056 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_1217 (glnA) glutamine synthetase [1] (data from MRSA252) NWMN_1937 (groEL) chaperonin GroEL [1] (data from MRSA252) NWMN_1938 (groES) co-chaperonin GroES [1] (data from MRSA252) NWMN_0380 (guaB) inosine-5'-monophosphate dehydrogenase [1] (data from MRSA252) NWMN_0828 (gudB) NAD-specific glutamate dehydrogenase [1] (data from MRSA252) NWMN_1178 (infB) translation initiation factor IF-2 [1] (data from MRSA252) NWMN_0189 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) NWMN_0176 (ldh1) L-lactate dehydrogenase [1] (data from MRSA252) NWMN_2028 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_0962 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) NWMN_1593 (pfk) 6-phosphofructokinase [1] (data from MRSA252) NWMN_0162 (pflB) formate acetyltransferase [1] (data from MRSA252) NWMN_0742 (pgk) phosphoglycerate kinase [1] (data from MRSA252) NWMN_0959 (phdA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) NWMN_0960 (phdB) pyruvate dehydrogenase E1 component, beta subunit [1] (data from MRSA252) NWMN_1183 (pnpA) polynucleotide phosphorylase/polyadenylase [1] (data from MRSA252) NWMN_1592 (pykA) pyruvate kinase [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_2152 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) NWMN_2151 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_2140 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_0501 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_0499 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_0502 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_2133 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_2136 (rplR) 50S ribosomal protein L18 [1] (data from MRSA252) NWMN_1151 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_1549 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_2147 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_2141 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) NWMN_0464 (rplY) 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_1547 (rpmA) 50S ribosomal protein L27 [1] (data from MRSA252) NWMN_2126 (rpoA) DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) NWMN_0504 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) NWMN_0505 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) NWMN_2032 (rpoE) DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) NWMN_2146 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_1613 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_2138 (rpsH) 30S ribosomal protein S8 [1] (data from MRSA252) NWMN_2119 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) NWMN_2153 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) NWMN_0008 (serS) seryl-tRNA synthetase [1] (data from MRSA252) NWMN_0055 (spa) immunoglobulin G binding protein A precursor (protein A) [1] (data from MRSA252) NWMN_1155 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) NWMN_1576 (thrS) threonyl-tRNA synthetase [1] (data from MRSA252) NWMN_1569 (tig) trigger factor [1] (data from MRSA252) NWMN_0743 (tpiA) triosephosphate isomerase [1] (data from MRSA252) NWMN_1057 (trxA) thioredoxin [1] (data from MRSA252) NWMN_1167 (tsf) elongation factor Ts [1] (data from MRSA252) NWMN_0510 (tufA) elongation factor Tu [1] (data from MRSA252) NWMN_2016 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_0249 5'-nucleotidase, lipoprotein e(P4) family protein [1] (data from MRSA252) NWMN_0377 hypothetical protein [1] (data from MRSA252) NWMN_0475 cysteine synthase-like protein [1] (data from MRSA252) NWMN_0721 sigma 54 modulation protein [1] (data from MRSA252) NWMN_0885 hypothetical protein [1] (data from MRSA252) NWMN_1333 phosphotransferase system glucose-specific IIA component [1] (data from MRSA252) NWMN_1643 D-alanine aminotransferase [1] (data from MRSA252) NWMN_1644 dipeptidase PepV [1] (data from MRSA252) NWMN_2086 alkaline shock protein 23 [1] (data from MRSA252) NWMN_2454 1-pyrroline-5-carboxylate dehydrogenase [1] (data from MRSA252) NWMN_2503 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252) NWMN_2504 malate:quinone oxidoreductase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: ndk < hepT < ubiE < NWMN_1381
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 1.76 1.77 1.78 1.79 1.80 1.81 1.82 1.83 1.84 1.85 1.86 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)