NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1219 [new locus tag: NWMN_RS06855 ]
- pan locus tag?: SAUPAN003631000
- symbol: NWMN_1219
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1219 [new locus tag: NWMN_RS06855 ]
- symbol: NWMN_1219
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1346001..1346207
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330721 NCBI
- RefSeq: YP_001332253 NCBI
- BioCyc:
- MicrobesOnline: 3706771 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATGAGATTGAAACTATTATAAGTGAAATAGAAAAGTTATTAACTAACAATACACCA
TATAGTATTTCAAAAAACTCAGGTGTACCACGTCAAACAGTTACTGATTTAAAGGTAGGT
AAAACTAAAATAAAAGAAGCTAAATTTAAAACGATAATCAAGTTATATGAATATCAAAGA
ACATTAGAAAATAAAACAGAATGTTAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1219 [new locus tag: NWMN_RS06855 ]
- symbol: NWMN_1219
- description: hypothetical protein
- length: 68
- theoretical pI: 9.54573
- theoretical MW: 7864.05
- GRAVY: -0.658824
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined PGDH_C; Phosphogluconate dehydrogenase (decarboxylating) C-term (PF16896; HMM-score: 13.3)HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 12.9)no clan defined AbbA_antirepres; Antirepressor AbbA (PF14156; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010249
- TAT(Tat/SPI): 0.001045
- LIPO(Sec/SPII): 0.001955
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNEIETIISEIEKLLTNNTPYSISKNSGVPRQTVTDLKVGKTKIKEAKFKTIIKLYEYQRTLENKTEC
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.