Jump to navigation
Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...") |
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism") |
||
Line 1: | Line 1: | ||
<protect> | <protect> | ||
<aureodatabase>NCBI date</aureodatabase> | |||
=Summary= | =Summary= | ||
Revision as of 16:36, 11 January 2016
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1124 [new locus tag: NWMN_RS06350 ]
- pan locus tag?: SAUPAN003497000
- symbol: NWMN_1124
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1124 [new locus tag: NWMN_RS06350 ]
- symbol: NWMN_1124
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1233094..1233297
- length: 204
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330686 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCAAGTAAACAAAGTTATTTATATTTTATTAGCATTGTTCTTAGGTAGTTTTGGTATT
CATAAATTTTATGCCGGCAAGAATATGCAAGGTATTCTACACTTAATATTCTGTTGGACA
GGTATCCCACACATTTTAGCAATTATTAGTGCAGTGATTACTGTTTTCAAACCTGCTGAT
GAACAAGGTAATGTCACTTTATAA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1124 [new locus tag: NWMN_RS06350 ]
- symbol: NWMN_1124
- description: hypothetical protein
- length: 67
- theoretical pI: 9.23713
- theoretical MW: 7428.91
- GRAVY: 0.891045
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined TM2; TM2 domain (PF05154; HMM-score: 63.2)and 2 moreBorrelia_P13; Borrelia membrane protein P13 (PF05628; HMM-score: 13.9)DUF2651; Protein of unknown function (DUF2651) (PF10852; HMM-score: 13.3)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.035551
- TAT(Tat/SPI): 0.000489
- LIPO(Sec/SPII): 0.039405
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHLIFCWTGIPHILAIISAVITVFKPADEQGNVTL
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)