From AureoWiki
Revision as of 14:32, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1071 [new locus tag: NWMN_RS06065 ]
  • pan locus tag?: SAUPAN003414000
  • symbol: NWMN_1071
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1071 [new locus tag: NWMN_RS06065 ]
  • symbol: NWMN_1071
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1174748..1174933
  • length: 186
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATAAACATATAAATAAAAAAGCCGCAAAACTACTTGAAGATTATAAAAAGGTTCAA
    CAAAGAAAATCGAAAGAAACTGATAGAGGTTGTTTGAAAAGTGTCATCATGCTTATCGTC
    TTATTTTTCTTAATTATTTTTGGTATTGTGGCATGTTCTACAAACGTAAACTTTTTCTTC
    CAGTAA
    60
    120
    180
    186

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1071 [new locus tag: NWMN_RS06065 ]
  • symbol: NWMN_1071
  • description: hypothetical protein
  • length: 61
  • theoretical pI: 10.5554
  • theoretical MW: 7109.53
  • GRAVY: 0.165574

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325
  • PFAM:
    no clan defined ERGIC_N; Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) (PF13850; HMM-score: 16.7)
    and 1 more
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 11.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: GIVACST
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.020428
    • TAT(Tat/SPI): 0.000903
    • LIPO(Sec/SPII): 0.373813
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNKHINKKAAKLLEDYKKVQQRKSKETDRGCLKSVIMLIVLFFLIIFGIVACSTNVNFFFQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]