NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0965 [new locus tag: NWMN_RS05410 ]
- pan locus tag?: SAUPAN003323000
- symbol: potA
- pan gene symbol?: potA
- synonym:
- product: spermidine/putrescine ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0965 [new locus tag: NWMN_RS05410 ]
- symbol: potA
- product: spermidine/putrescine ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 1071142..1072236
- length: 1095
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330576 NCBI
- RefSeq: YP_001331999 NCBI
- BioCyc:
- MicrobesOnline: 3706516 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081TTGGAACCGTTATTATCATTAAAATCAGTTAGTAAAAGCTATGATGATCTTAATATCTTA
GATGACATAGATATTGATATTGAATCAGGATACTTTTATACATTATTAGGTCCTTCAGGT
TGTGGTAAAACAACAATTTTAAAATTAATTGCAGGGTTTGAATATCCTGACAGTGGTGAA
GTGATTTATCAAAACAAACCAATTGGTAATTTACCACCAAATAAACGTAAAGTGAATACA
GTCTTTCAAGATTATGCATTATTTCCACACTTAAACGTCTATGATAATATCGCTTTTGGT
TTGAAATTAAAAAAATTATCAAAAACCGAAATTGATCAAAAAGTAACTGAGGCATTAAAA
TTAGTAAAACTTTCAGGTTATGAAAAAAGAAATATTAATGAAATGAGTGGCGGACAAAAG
CAACGTGTTGCAATTGCACGTGCTATCGTAAATGAACCAGAAATATTATTGTTAGATGAA
TCTTTATCCGCATTAGATTTGAAATTGCGTACTGAAATGCAATATGAATTACGAGAATTG
CAATCTAGATTAGGTATTACATTTATATTTGTAACACATGATCAAGAAGAAGCGTTAGCA
TTAAGTGACTTTCTTTTTGTATTAAAAGATGGGAAAATTCAACAATTTGGCACACCAACA
GATATATATGACGAACCAGTGAATCGATTTGTAGCTGATTTTATTGGAGAATCTAATATT
GTTGAAGGGCGCATGGTTAGAGATTATGTCGTGAATATTTATGGGCAAGATTTCGAATGT
GTCGATATGGGTATTCCTGAAAATAAAAAAGTAGAAGTCGTTATTCGACCAGAAGATATA
TCATTAATCAAAGCTGAAGAAGGATTATTTAAAGCAACTGTTGATTCTATGTTATTTAGA
GGGGTCCACTATGAAATATGTTGTATAGACAATAAAGGTTATGAATGGGTAATACAAACG
ACTAAAAAAGCTGAAGTAGGCAGTGAAGTTGGTCTTTATTTTGATCCTGAAGCCATTCAT
ATTATGGTTCCTGGAGAAACAGAAGAAGAATTTGATAAACGTATTGAAAGCTATGAGGAA
GTAGACAATGCGTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1095
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0965 [new locus tag: NWMN_RS05410 ]
- symbol: PotA
- description: spermidine/putrescine ABC transporter ATP-binding protein
- length: 364
- theoretical pI: 4.36604
- theoretical MW: 41329.8
- GRAVY: -0.231868
⊟Function[edit | edit source]
- reaction: EC 3.6.3.31? ExPASyPolyamine-transporting ATPase ATP + H2O + polyamine(Out) = ADP + phosphate + polyamine(In)
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 354.1)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 351.8)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 292.7)and 71 moreTransport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 273.3)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 227)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 186)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 174.5)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 166.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 166.2)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 164.3)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 164.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 161)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 159.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 159.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 156.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 151.1)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 147.9)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 143.8)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 142.5)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 142)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 138.8)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 135)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 130.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 130.8)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 130)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 129.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 128.3)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 128.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 122.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 122.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 121.8)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 120.5)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 117.7)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 113.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 113.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 111.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 110)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 110)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 108.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 108.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 108.2)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 107.6)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 101.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 98)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 97.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 96)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 95.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 90.6)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 88.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 87)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 78.3)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 77)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 71)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 68.5)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 68)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 68)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 64.2)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.1)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 58.8)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 49.2)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 44.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 42.7)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 36.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.1)ribosomal protein eL8 (TIGR03677; HMM-score: 15.9)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 12.2)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.3)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 118.2)and 14 moreOB (CL0021) TOBE_2; TOBE domain (PF08402; HMM-score: 34.6)P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 31.9)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 24.4)AAA_22; AAA domain (PF13401; HMM-score: 22.9)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.8)AAA_28; AAA domain (PF13521; HMM-score: 17.5)AAA_15; AAA ATPase domain (PF13175; HMM-score: 15.5)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 14.2)AAA_23; AAA domain (PF13476; HMM-score: 14)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.8)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.5)AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.5)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 12.3)Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01071
- TAT(Tat/SPI): 0.000593
- LIPO(Sec/SPII): 0.002746
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGEVIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALKLVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELRELQSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNIVEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFRGVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEEVDNA
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.