From AureoWiki
Revision as of 16:28, 11 January 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0775 [new locus tag: NWMN_RS04380 ]
  • symbol: NWMN_0775
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 866292..866648
  • length: 357
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 5330454 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAATTTTACCAATATAAGAATTGTACAACTTGTAAAAAGGCAGCAAAGTTTTTA
    GATGAATATGGCGTAAGTTATGAACCAATTGATATCGTTCAACATACACCTACAATAAAT
    GAATTTAAAACAATAATTGCAAATACAGGCGTAGAAATTAATAAATTGTTTAATACACAC
    GGCGCGAAATATCGTGAGCTTGATTTGAAAAATAAATTACAAACTTTATCAGATGATGAA
    AAGTTAGAGTTGTTATCATCTGATGGTATGTTAGTAAAGCGTCCTCTAGCAGTAATGGGC
    GATAAGATAACATTAGGATTTAAAGAAGATCAATATAAAGAGACTTGGTTAGCGTAA
    60
    120
    180
    240
    300
    357

Protein[edit | edit source]

Protein Data Bank: 2M46

General[edit | edit source]

  • locus tag: NWMN_0775 [new locus tag: NWMN_RS04380 ]
  • symbol: NWMN_0775
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 7.40662
  • theoretical MW: 13599.6
  • GRAVY: -0.445763

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 155)
    and 7 more
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 40.2)
    Cellular processes Cellular processes Detoxification arsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 39.4)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 32.5)
    Unknown function General nitrogenase-associated protein (TIGR01616; HMM-score: 30.5)
    glutaredoxin-like protein (TIGR02200; HMM-score: 24.3)
    Metabolism Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 22.5)
    glutaredoxin-family domain (TIGR02190; HMM-score: 12.7)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 52.6)
    and 2 more
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 31.4)
    Concanavalin (CL0004) Spike_NTD; Spike glycoprotein N-terminal domain (PF16451; HMM-score: 12.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006247
    • TAT(Tat/SPI): 0.000081
    • LIPO(Sec/SPII): 0.001464
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 151220987 NCBI
  • UniProt: A0A0H3KF92 UniProt
  • protein Genbank : _
  • RefSeq: YP_001331809 NCBI

Protein sequence[edit | edit source]

  • MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA

Peptides[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]