NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0765 [new locus tag: NWMN_RS04325 ]
- pan locus tag?: SAUPAN002806000
- symbol: NWMN_0765
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0765 [new locus tag: NWMN_RS04325 ]
- symbol: NWMN_0765
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 859972..860160
- length: 189
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330444 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
TTTATACTCGTATTAATGAAAAAAACTAGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
TTCACTATCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
GTGCTATAA60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0765 [new locus tag: NWMN_RS04325 ]
- symbol: NWMN_0765
- description: hypothetical protein
- length: 62
- theoretical pI: 10.0084
- theoretical MW: 7186.81
- GRAVY: 1.46452
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for N315, NCTC8325
- PFAM: no clan defined BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 15.4)GPCR_A (CL0192) Bac_rhodopsin; Bacteriorhodopsin-like protein (PF01036; HMM-score: 15.1)no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 14)Intg_mem_TP0381; Integral membrane protein (intg_mem_TP0381) (PF09529; HMM-score: 13.8)DUF3742; Protein of unknown function (DUF3742) (PF12553; HMM-score: 12.4)and 15 morePGG; Domain of unknown function (PF13962; HMM-score: 12.2)SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 11.8)SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 11.7)MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 11.5)DUF3671; Protein of unknown function (PF12420; HMM-score: 11)TEX29; Testis-expressed sequence 29 protein (PF15839; HMM-score: 10.8)Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 10.7)no clan defined DUF4051; Protein of unknown function (DUF4051) (PF13260; HMM-score: 10.2)CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.9)NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 9.6)no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.9)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 8.9)Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 8.2)no clan defined Tmemb_55A; Transmembrane protein 55A (PF09788; HMM-score: 6)DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 4.9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009117
- TAT(Tat/SPI): 0.000759
- LIPO(Sec/SPII): 0.123124
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTIILYIFGFAILIYTFIFGVL
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.