Jump to navigation
Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene GI</aureodatabase> | *<aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene RefSeq</aureodatabase> | ||
*<aureodatabase>gene BioCyc</aureodatabase> | |||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 78: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 97: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 106: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 107: | Line 114: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 124: | Line 134: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 130: | Line 140: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 137: | Line 146: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 143: | Line 152: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 12:38, 10 March 2016
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0630 [new locus tag: NWMN_RS03580 ]
- pan locus tag?: SAUPAN002540000
- symbol: vraF
- pan gene symbol?: vraF
- synonym:
- product: ABC transporter ATP-binding protein VraF
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0630 [new locus tag: NWMN_RS03580 ]
- symbol: vraF
- product: ABC transporter ATP-binding protein VraF
- replicon: chromosome
- strand: +
- coordinates: 711227..711988
- length: 762
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330348 NCBI
- RefSeq: YP_001331664 NCBI
- BioCyc:
- MicrobesOnline: 3706177 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGGCAATTTTAGAAGTAAAACAATTAACAAAAATATATGGAACTAAAAAAATGGCACAA
GAAGTGTTGCGAGATATCAATATGTCTATTGAAGAAGGCGAGTTTATTGCTATTATGGGT
CCCTCTGGATCTGGGAAAACGACATTATTAAATGTTTTAAGTTCAATTGATTATATTTCA
CAAGGTTCTATTACATTAAAAGGAAAAAAATTAGAAAAGCTTTCAAACAAGGAATTATCT
GATATACGCAAGCATGATATTGGTTTTATTTTTCAAGAGTATAATTTACTGCATACATTG
ACTGTTAAAGAAAACATAATGTTACCACTAACGGTACAGAAGTTAGATAAAGAACATATG
TTAAATCGTTATGAAAAAGTAGCAGAAGCATTAAATATATTGGATATTAGTGATAAATAT
CCCTCTGAATTGTCTGGTGGACAAAGGCAACGAACATCAGCTGCCAGAGCATTTATAACA
TTGCCTTCTATTATATTTGCTGACGAACCAACAGGTGCACTGGATTCTAAAAGTACTCAA
GATTTATTAAAACGATTAACAAGAATGAATGAAGCATTTAAGTCTACAATTATTATGGTA
ACGCATGATCCTGTTGCAGCAAGCTATGCAAATCGAGTAGTGATGCTAAAAGATGGTCAA
ATTTTCACTGAATTATACCAAGGGGATGACGATAAACATACCTTTTTCAAAGAAATAATA
CGTGTACAAAGTGTTTTAGGTGGCGTTAATTATGACCTTTAA60
120
180
240
300
360
420
480
540
600
660
720
762
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0630 [new locus tag: NWMN_RS03580 ]
- symbol: VraF
- description: ABC transporter ATP-binding protein VraF
- length: 253
- theoretical pI: 7.0941
- theoretical MW: 28462.7
- GRAVY: -0.209881
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 215.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 202.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 185.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 179.7)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 179.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 176.4)and 82 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 158.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.4)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 149.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 149.1)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 143.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 134.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 132.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 131.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 131.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 131)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 127.1)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 126.9)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 126.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 125.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 125.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 122)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 120.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 119.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 118)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 116.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 116)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 108.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 101.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 99.4)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 96.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 96.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 96.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 94.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 91.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 90.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 87)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 86.3)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 85.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 84.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 77.6)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 75.3)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 72.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 71.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 67.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 56.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 45.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 40)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 38.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 37.1)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 17.8)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 14.8)Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 14.5)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.3)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 14.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 14.2)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.7)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.5)Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 13.2)Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 13.2)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.1)helicase/secretion neighborhood ATPase (TIGR03819; HMM-score: 13.1)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.9)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.9)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.3)Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 11.8)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.4)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 107.4)and 24 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 35.8)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 28.1)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 25)AAA_16; AAA ATPase domain (PF13191; HMM-score: 23.1)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 21.7)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 20)AAA_22; AAA domain (PF13401; HMM-score: 18.3)AAA_25; AAA domain (PF13481; HMM-score: 18.2)AAA_18; AAA domain (PF13238; HMM-score: 17.6)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.1)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 16.3)AAA_28; AAA domain (PF13521; HMM-score: 15.9)AAA_30; AAA domain (PF13604; HMM-score: 15.2)NACHT; NACHT domain (PF05729; HMM-score: 14.9)NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.8)AAA_23; AAA domain (PF13476; HMM-score: 14.6)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 14.1)AAA_24; AAA domain (PF13479; HMM-score: 13.3)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.1)Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 13.1)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 12.9)RNA_helicase; RNA helicase (PF00910; HMM-score: 12.7)PhoH; PhoH-like protein (PF02562; HMM-score: 12.7)RNA12; RNA12 protein (PF10443; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003923
- TAT(Tat/SPI): 0.00028
- LIPO(Sec/SPII): 0.000354
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYISQGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHMLNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQDLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEIIRVQSVLGGVNYDL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_1605 (ackA) acetate kinase [1] (data from MRSA252) NWMN_2131 (adk) adenylate kinase [1] (data from MRSA252) NWMN_0372 (ahpC) alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) NWMN_2534 (arcA) arginine deiminase [1] (data from MRSA252) NWMN_1587 (citC) isocitrate dehydrogenase [1] (data from MRSA252) NWMN_1588 (citZ) citrate synthase [1] (data from MRSA252) NWMN_0736 (clpP) ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) NWMN_1165 (codY) transcriptional repressor CodY [1] (data from MRSA252) NWMN_2042 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) NWMN_0805 (dltC) D-alanine--poly(phosphoribitol) ligase subunit 2 [1] (data from MRSA252) NWMN_1483 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) NWMN_0082 (dra) deoxyribose-phosphate aldolase [1] (data from MRSA252) NWMN_0745 (eno) phosphopyruvate hydratase [1] (data from MRSA252) NWMN_0551 (eutD) phosphotransacetylase [1] (data from MRSA252) NWMN_1141 (fabG) 3-oxoacyl-[acyl-carrier protein] reductase [1] (data from MRSA252) NWMN_2029 (fbaA) fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_1625 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) NWMN_0932 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [1] (data from MRSA252) NWMN_1169 (frr) ribosome recycling factor [1] (data from MRSA252) NWMN_1096 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) NWMN_0509 (fus) elongation factor G [1] (data from MRSA252) NWMN_0741 (gapA) glyceraldehyde 3-phosphate dehydrogenase 1 [1] (data from MRSA252) NWMN_1580 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) NWMN_1838 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) NWMN_1837 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) NWMN_1440 (gcvPA) glycine dehydrogenase subunit 1 [1] (data from MRSA252) NWMN_2056 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_1217 (glnA) glutamine synthetase [1] (data from MRSA252) NWMN_2017 (glyA) serine hydroxymethyltransferase [1] (data from MRSA252) NWMN_1468 (glyS) glycyl-tRNA synthetase [1] (data from MRSA252) NWMN_1417 (gnd) 6-phosphogluconate dehydrogenase [1] (data from MRSA252) NWMN_1937 (groEL) chaperonin GroEL [1] (data from MRSA252) NWMN_0381 (guaA) GMP synthase [1] (data from MRSA252) NWMN_0380 (guaB) inosine-5'-monophosphate dehydrogenase [1] (data from MRSA252) NWMN_0828 (gudB) NAD-specific glutamate dehydrogenase [1] (data from MRSA252) NWMN_0516 (ilvE) branched-chain amino acid aminotransferase [1] (data from MRSA252) NWMN_0176 (ldh1) L-lactate dehydrogenase [1] (data from MRSA252) NWMN_1334 (msrB) methionine sulfoxide reductase B [1] (data from MRSA252) NWMN_0701 (nrdF) ribonucleotide-diphosphate reductase subunit beta [1] (data from MRSA252) NWMN_1176 (nusA) transcription elongation factor NusA [1] (data from MRSA252) NWMN_0498 (nusG) transcription antitermination protein [1] (data from MRSA252) NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_0962 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) NWMN_2040 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) NWMN_1593 (pfk) 6-phosphofructokinase [1] (data from MRSA252) NWMN_0162 (pflB) formate acetyltransferase [1] (data from MRSA252) NWMN_0833 (pgi) glucose-6-phosphate isomerase [1] (data from MRSA252) NWMN_0742 (pgk) phosphoglycerate kinase [1] (data from MRSA252) NWMN_0744 (pgm) phosphoglyceromutase [1] (data from MRSA252) NWMN_0959 (phdA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) NWMN_1050 (pheT) phenylalanyl-tRNA synthetase subunit beta [1] (data from MRSA252) NWMN_2438 (poxB) pyruvate oxidase [1] (data from MRSA252) NWMN_0463 (prs) ribose-phosphate pyrophosphokinase [1] (data from MRSA252) NWMN_1592 (pykA) pyruvate kinase [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_2149 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_2152 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) NWMN_2151 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_2140 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_2137 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_0014 (rplI) 50S ribosomal protein L9 [1] (data from MRSA252) NWMN_0501 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_0499 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_0502 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_2120 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) NWMN_2133 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_2125 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) NWMN_1151 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_1549 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_2147 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_2150 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) NWMN_0464 (rplY) 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_0504 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) NWMN_0505 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) NWMN_1385 (rpsA) 30S ribosomal protein S1 [1] (data from MRSA252) NWMN_1166 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_2146 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_1613 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_2135 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_0357 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) NWMN_0508 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) NWMN_2138 (rpsH) 30S ribosomal protein S8 [1] (data from MRSA252) NWMN_2119 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) NWMN_2153 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) NWMN_2127 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_2143 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) NWMN_2148 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) NWMN_1456 (sodA) superoxide dismutase Mn/Fe family protein [1] (data from MRSA252) NWMN_0055 (spa) immunoglobulin G binding protein A precursor (protein A) [1] (data from MRSA252) NWMN_1325 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) NWMN_1155 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) NWMN_1156 (sucD) succinyl-CoA synthetase subunit alpha [1] (data from MRSA252) NWMN_1569 (tig) trigger factor [1] (data from MRSA252) NWMN_1254 (tkt) transketolase [1] (data from MRSA252) NWMN_0743 (tpiA) triosephosphate isomerase [1] (data from MRSA252) NWMN_1057 (trxA) thioredoxin [1] (data from MRSA252) NWMN_1167 (tsf) elongation factor Ts [1] (data from MRSA252) NWMN_0510 (tufA) elongation factor Tu [1] (data from MRSA252) NWMN_2016 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_0346 acetyl-CoA acetyltransferase [1] (data from MRSA252) NWMN_0443 hypothetical protein [1] (data from MRSA252) NWMN_0475 cysteine synthase-like protein [1] (data from MRSA252) NWMN_0481 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) NWMN_0482 glutamine amidotransferase subunit PdxT [1] (data from MRSA252) NWMN_0655 MarR family regulatory protein [1] (data from MRSA252) NWMN_0721 sigma 54 modulation protein [1] (data from MRSA252) NWMN_0776 glycine cleavage system protein H [1] (data from MRSA252) NWMN_0811 hypothetical protein [1] (data from MRSA252) NWMN_0839 fumarylacetoacetate hydrolase family protein [1] (data from MRSA252) NWMN_0854 3-oxoacyl-(acyl-carrier-protein) synthase II [1] (data from MRSA252) NWMN_0870 oligoendopeptidase F [1] (data from MRSA252) NWMN_0885 hypothetical protein [1] (data from MRSA252) NWMN_0949 phosphocarrier protein HPr [1] (data from MRSA252) NWMN_0950 phosphoenolpyruvate-protein phosphatase [1] (data from MRSA252) NWMN_1263 aconitate hydratase [1] (data from MRSA252) NWMN_1333 phosphotransferase system glucose-specific IIA component [1] (data from MRSA252) NWMN_1382 DNA-binding protein HU [1] (data from MRSA252) NWMN_1516 hypothetical protein [1] (data from MRSA252) NWMN_1600 universal stress protein family protein [1] (data from MRSA252) NWMN_1602 proline dipeptidase-like protein [1] (data from MRSA252) NWMN_1604 universal stress protein family protein [1] (data from MRSA252) NWMN_1644 dipeptidase PepV [1] (data from MRSA252) NWMN_1672 putative translaldolase [1] (data from MRSA252) NWMN_1831 ferritin [1] (data from MRSA252) NWMN_1857 putative manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) NWMN_2086 alkaline shock protein 23 [1] (data from MRSA252) NWMN_2422 D-lactate dehydrogenase [1] (data from MRSA252) NWMN_2503 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252) NWMN_2504 malate:quinone oxidoreductase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for NCTC8325
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)