NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0014 [new locus tag: NWMN_RS00075 ]
- pan locus tag?: SAUPAN000025000
- symbol: rplI
- pan gene symbol?: rplI
- synonym:
- product: 50S ribosomal protein L9
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0014 [new locus tag: NWMN_RS00075 ]
- symbol: rplI
- product: 50S ribosomal protein L9
- replicon: chromosome
- strand: +
- coordinates: 20289..20735
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5329925 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAA
GTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACA
CCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAA
GAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCA
GCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAA
GCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGA
ATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACA
ATTCGCGTACACACAGTTGAACAATAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0014 [new locus tag: NWMN_RS00075 ]
- symbol: RplI
- description: 50S ribosomal protein L9
- length: 148
- theoretical pI: 10.0654
- theoretical MW: 16453.8
- GRAVY: -0.681757
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL9 (TIGR00158; HMM-score: 149.7)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined Ribosomal_L9_C; Ribosomal protein L9, C-terminal domain (PF03948; HMM-score: 98.6)and 1 moreRibosomal_L9_N; Ribosomal protein L9, N-terminal domain (PF01281; HMM-score: 78.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
NWMN_1592 (pykA) pyruvate kinase [1] (data from MRSA252) NWMN_2151 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_0501 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_0499 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_0428 ABC transporter substrate-binding protein [1] (data from MRSA252) NWMN_0641 hypothetical protein [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005569
- TAT(Tat/SPI): 0.00029
- LIPO(Sec/SPII): 0.00142
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
⊟Peptides[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: NWMN_0012 > NWMN_0013 > rplI > dnaB
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)